PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0076s00540.1
Common NameLR48_Vigan08g091400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family VOZ
Protein Properties Length: 493aa    MW: 55166.2 Da    PI: 5.4707
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0076s00540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ413.44e-1272394651217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       pppsafl+pkcalwdc+rpaqg+ew+++ycss+h+ la neglpg+tp+lrp+gi++kdg+lfaa+ ak+qgkevgip+cegaa++kspwna+
  Vang0076s00540.1 239 PPPSAFLAPKCALWDCFRPAQGVEWCRNYCSSCHELLANNEGLPGMTPILRPGGIGVKDGPLFAAVLAKTQGKEVGIPSCEGAASTKSPWNAP 331
                       89*****************************************************************************************96 PP

               VOZ  94 ..........elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeine 176
                                 e+fdls+lege+irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmke+gg+krsyymdpqp+s++ewhlyeyein+
  Vang0076s00540.1 332 glkcylfsgaEFFDLSFLEGEAIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEHGGQKRSYYMDPQPLSYLEWHLYEYEINN 424
                       555555555589********************************************************************************* PP

               VOZ 177 ldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                        d +alyrlelklv++kks+kgkv+k+sl+dlq+k+g+lta
  Vang0076s00540.1 425 HDGCALYRLELKLVEKKKSPKGKVTKESLNDLQNKMGQLTA 465
                       ***************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MMRESSKGKF GSSSIQSMKE KEKHLVDKIQ GIFSNLQCAR KEGRGSDIVI FEEQMHQLLR  60
EWKAELESPA TSLADGSFDS FTSELAQLLQ VIEEKDDATS PLTKPGPLKT ELQTSNINDN  120
NFQFFQEKHF DDNQPLGHNF EGSASTLYNN AFNNSDMEQL DFHPFSLNQD MNHNQVGHNS  180
DLIGXVDLYQ DLGHNTEIKH SESNQFSIEG FDCSQFFGAE DTVHHGXNII PNILPNICPP  240
PSAFLAPKCA LWDCFRPAQG VEWCRNYCSS CHELLANNEG LPGMTPILRP GGIGVKDGPL  300
FAAVLAKTQG KEVGIPSCEG AASTKSPWNA PGLKCYLFSG AEFFDLSFLE GEAIREWLFF  360
DKPRRAFESG NRKQRSLPDY SGRGWHESRK QVMKEHGGQK RSYYMDPQPL SYLEWHLYEY  420
EINNHDGCAL YRLELKLVEK KKSPKGKVTK ESLNDLQNKM GQLTAAVLSS DDGIPIKGKT  480
NAKSENDGSP EN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492703.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_014492704.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-152VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0L9V5690.0A0A0L9V569_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SAZ70.0A0A0S3SAZ7_PHAAN; Uncharacterized protein
STRINGGLYMA06G43890.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-143vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]